PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa20g005610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family NAC
Protein Properties Length: 658aa    MW: 73672.3 Da    PI: 4.154
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa20g005610.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.33e-53101371128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv +yLk+kv +k++++ ++i+ +diyk+ePwdLp k k+k+++ ewyfFs  dkky++g+++nrat++gyWk+tgkd+e+ 
  Csa20g005610.1  10 LAPGFRFHPTDEELVRYYLKRKVCNKPFKF-DAISVTDIYKSEPWDLPdKsKLKSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIR 103
                     579**************************9.99**************95347777888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + ++++vg+kktLv++kgrap+ge+t+Wvmheyrl
  Csa20g005610.1 104 N-GSRVVGMKKTLVYHKGRAPRGERTNWVMHEYRL 137
                     9.9******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-618160IPR003441NAC domain
PROSITE profilePS5100558.57610160IPR003441NAC domain
PfamPF023657.0E-2812137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MGRDSVTTSL APGFRFHPTD EELVRYYLKR KVCNKPFKFD AISVTDIYKS EPWDLPDKSK  60
LKSRDLEWYF FSMLDKKYSN GSKTNRATEK GYWKTTGKDR EIRNGSRVVG MKKTLVYHKG  120
RAPRGERTNW VMHEYRLSDE DLKRAGVPQE AYVLCRIFQK SGTGPKNGEQ YGAPFLEEEW  180
EEDAMTYVPD QDAFSEGLAV DDDVYVDIDE IDEKPENLVI YDAVPILPNY CHGESSNNVE  240
SGNHSDSGNY IQPGNYVVDS GGYFEQPIET FEEDKKPIIR DGSIQPCSLF PEEHIDCGVQ  300
DENAVNLDSS NNNVFVAADT CYSDVPIDTN YLPDEPFMDP NNSLPLNDGN YVVDSGGYFE  360
QPIETFEEDK KPIIRDGSIQ PCSLFPEEHI DCGVQDENAV NLDSSNNNVF VAADTCYSDV  420
PIDTNYLPDE PFMDPNNSLP LNDGLYLETN DLSIAQQDDF NFEDYLNDFN FDEDGFTLDD  480
PELDALLDQK PAPEELEKEV AEGKEMVEKK DSGEGSSSKQ DADLTDFDSA SKYPFLKKTS  540
HMLGSIPAPS SFASQFKSKD AAIRLHSESS GSVHVTAGMI RISNMTLAAD SSMGWSYDKN  600
GNLNVILSFG VVQRDDELNA TGSKTGTTET RAMLIFMCLW VLVLSVSFKI GTMVSAR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-44916616171NAC domain-containing protein 19
4dul_A4e-44916616171NAC domain-containing protein 19
1ut7_B4e-44916616171NO APICAL MERISTEM PROTEIN
1ut7_A4e-44916616171NO APICAL MERISTEM PROTEIN
1ut4_B4e-44916616171NO APICAL MERISTEM PROTEIN
1ut4_A4e-44916616171NO APICAL MERISTEM PROTEIN
3swp_D5e-44916619174NAC domain-containing protein 19
3swp_C5e-44916619174NAC domain-containing protein 19
3swp_B5e-44916619174NAC domain-containing protein 19
3swp_A5e-44916619174NAC domain-containing protein 19
3swm_D5e-44916619174NAC domain-containing protein 19
3swm_C5e-44916619174NAC domain-containing protein 19
3swm_B5e-44916619174NAC domain-containing protein 19
3swm_A5e-44916619174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0996090.0AY099609.1 Arabidopsis thaliana putative protein (At5g04410) mRNA, complete cds.
GenBankAY1288590.0AY128859.1 Arabidopsis thaliana putative protein (At5g04410) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010490951.10.0PREDICTED: NAC domain-containing protein 78-like isoform X4
RefseqXP_010490950.10.0PREDICTED: NAC domain-containing protein 78-like isoform X3
SwissprotQ84K000.0NAC78_ARATH; NAC domain-containing protein 78
TrEMBLD7LXI40.0D7LXI4_ARALL; Putative uncharacterized protein
STRINGscaffold_600382.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.10.0NAC domain containing protein 2